swiss-solidarity.org is a domain that was created on 2000-03-08,making it 24 years ago. It has several subdomains, such as media.swiss-solidarity.org , among others.
Description:Swiss Solidarity collects donations and ensures that they go towards high quality humanitarian and...
Discover swiss-solidarity.org website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site
HomePage size: 171.936 KB |
Page Load Time: 0.325213 Seconds |
Website IP Address: 192.124.249.130 |
Bordier & Cie, Swiss Private Bank faqs.bordier.com |
The Swiss Grid swissgrid.posterhouse.org |
Elna master shop – Swiss design global.elna.com |
swiss smile Dental Beauty – Stay shop.swiss-smile.beauty |
My Swiss Kitchen - Feeding Foodies in the Alps myswisskitchen.swisshikingvacations.com |
La Colline - Exceptional Swiss-Made skincare ch.lacolline-skincare.com |
edel+white Swiss Dental Experts en.edelwhite.swiss |
Swiss Rifles dot com - The message board is dedicated to the arms and equipment carried by Swiss sol theswissriflesdotcommessageboard.yuku.com |
Future Finance | Sygnum Bank - Invest in crypto with a regulated Swiss bank www.insights.sygnum.com |
Switzerland Escorts - Swiss Escort Directory - TopEscortBabes switzerland.topescortbabes.com |
Welcome to the Swiss Bakery Online Shop-n-Ship | Gourmet Swiss Foods, Cheese for Raclette, Sausages theswissbakeryonline.americommerce.com |
Swiss Re 2023 Annual Report | Swiss Re Annual Report reports.swissre.com |
FIDE Grand Swiss 2023 – FIDE Grand Swiss 2023 chess tournament official grandswiss.fide.com |
Swiss Solidarity https://www.swiss-solidarity.org/ |
News https://www.swiss-solidarity.org/news/ |
Swiss Solidarity: Donate https://donation.swiss-solidarity.org/ |
Swiss Solidarity's program for regular donations https://www.swiss-solidarity.org/forsolidarity/ |
Donate https://donation.swiss-solidarity.org/pro23/ |
Heartbeats-Tour - Glückskette https://www.swiss-solidarity.org/heartbeats/ |
Subscribe to our newsletter https://www.swiss-solidarity.org/newsletter/ |
Legal Information - Donate https://donation.swiss-solidarity.org/legals |
Contact https://www.swiss-solidarity.org/contact/ |
The history of Swiss Solidarity https://www.swiss-solidarity.org/about-us/who-are-we/our-history/ |
Who are we - Swiss Solidarity's mission, history and activities https://www.swiss-solidarity.org/about-us/who-are-we/ |
Swiss Solidarity — 2022 Annual Report https://www.swiss-solidarity.org/about-us/annual-report/2022/ |
2020 Annual Report – Switzerland and its solidarity in action https://www.swiss-solidarity.org/2020-annual-report-switzerland-and-its-solidarity-in-action-swiss-solidarity/ |
Swiss Solidarity’s first “Solidarity Barometer” https://www.swiss-solidarity.org/swiss-solidarity-first-solidarity-barometer/ |
How do we operate – From donations to humanitarian aid - Swiss Solidarity https://www.swiss-solidarity.org/about-us/who-are-we/how-do-we-operate/ |
A swiss-solidarity.org. 300 IN A 192.124.249.130 |
AAAA swiss-solidarity.org. 300 IN AAAA 2a02:fe80:1010::30:8 |
MX swiss-solidarity.org. 300 IN MX 10 alt3.aspmx.l.google.com. |
NS swiss-solidarity.org. 3600 IN NS ns41.infomaniak.com. |
TXT swiss-solidarity.org. 300 IN TXT dj28nb56t27tb2hg2esdp91ngp |
SOA swiss-solidarity.org. 3600 IN SOA ns41.infomaniak.com. hostmaster.infomaniak.ch. 2024012501 10800 3600 605800 3600 |
Server: Sucuri/Cloudproxy |
Date: Wed, 15 May 2024 14:27:57 GMT |
Content-Type: text/html; charset=UTF-8 |
Transfer-Encoding: chunked |
Connection: keep-alive |
X-Sucuri-ID: 11030 |
X-XSS-Protection: 1; mode=block |
X-Frame-Options: SAMEORIGIN |
X-Content-Type-Options: nosniff |
Content-Security-Policy: upgrade-insecure-requests; |
link: https://www.swiss-solidarity.org/wp-json/; rel="https://api.w.org/", https://www.swiss-solidarity.org/wp-json/wp/v2/pages/1568; rel="alternate"; type="application/json", https://www.swiss-solidarity.org/; rel=shortlink |
strict-transport-security: max-age=16000000 |
vary: Accept-Encoding |
X-Sucuri-Cache: |
charset="utf-8"/ |
content="width=device-width, initial-scale=1" name="viewport"/ |
content="telephone=no" name="format-detection"/ |
content="#e5222f" name="theme-color"/ |
content="index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1" name="robots" |
content="Swiss Solidarity collects donations and ensures that they go towards high quality humanitarian and social projects." name="description" |
content="en_US" property="og:locale" |
content="website" property="og:type" |
content="Swiss Solidarity" property="og:title"/ |
content="Swiss Solidarity collects donations and ensures that they go towards high quality humanitarian and social projects." property="og:description"/ |
content="https://www.swiss-solidarity.org/" property="og:url"/ |
content="Swiss Solidarity" property="og:site_name"/ |
content="https://facebook.com/chainedubonheur" property="article:publisher"/ |
content="2024-03-04T15:30:24+00:00" |
Ip Country: United States |
City Name: Menifee |
Latitude: 33.6637 |
Longitude: -117.1743 |
Solidarity Newsletter Organisations International organisations Medias Recherche pour Rechercher EN IT FR DE FUNDRAISING CAMPAIGNS INTERNATIONAL IN SWITZERLAND YOUR SUPPORT DONATE INHERITANCE AND TESTAMENT COMPANIES VOLUNTEERING GRANT-MAKING FOUNDATIONS NEWS OUR FOUNDATION WHO ARE WE OUR FUNCTIONING OUR HISTORY OUR GOVERNANCE OUR TEAM FAQ OUR PARTNERS OUR PARTNER NGOs OUR CORPORATE PARTNERS SRG SSR ANNUAL REPORT ANNUAL REPORT 2023 ARCHIVE JOB VACANCIES Organisations International organisations Newsletter Medias EN FR DE IT Donate now © Keystone / AP / MOHAMMED SABER Many thanks for your support Humanitarian crisis in the Middle East Total amount of donations: CHF 5,396,257 Donate now Find out more © Keystone / AP / MOHAMMED SABER © Keystone / AP Working together for people in need Ukraine Total amount of donations: CHF 134,709,119 Donate Now Find out more © Keystone / AP © Enfants du Monde / Lauren Pasche Your donation makes a difference Child relief Total amount of donations: CHF 9,055,293 Donate now Find out more © Enfants du Monde / Lauren Pasche Our news 07.05.2024 SWISS SOLIDARITY IN 2023 – OUR ANNUAL REPORT In 2023, the solidarity of the population was demonstrated on several occasions, in particular for the victims of the earthquakes in Syria and... 12.03.2024 Appeal for solidarity with the victims of the conflict in the Middle East The humanitarian crisis in the Middle East, particularly in the Gaza Strip, is reaching an unprecedented level of urgency. We are once again... Subscribe to our newsletter now! Be the first to be informed of our news. Subscribe Find out more HOW DO WE OPERATE? We take action We make things possible We monitor Working with our 25 partner relief organizations means we can guarantee that your donations are used responsibly. Find out more We guarantee quality and ensure that your donation provides the most effective help possible to people in need whom you have chosen to support. Find out more Our current appeals Donate now Donated funds: 5,396,257 CHF Humanitarian crisis in the Middle East Humanitarian crisis in the Middle East: Solidarity (SwS) is calling for solidarity in Switzerland to help the civilian population suffering... Donate now Donate now Donated funds: 134,709,119 CHF Ukraine On 24 February 2022, the Russian invasion of Ukraine began. More than 10,000 civilians were killed and millions were forced to flee. ... Donate now Donate now Earthquake in Turkey and Syria On February 6, a 7.8 magnitude earthquake struck southern Turkey and Syria. Several thousand people lost their lives and major damage was caused... Donate now since 1946 SWISS SOLIDARITY Over 2 billion francs raised Thousands of volunteers have helped to raise donations With the help of media, who broadcast our fundraising appeals IBAN: CH82 0900 0000 1001 5000 6 Solidarity, 1211 Geneva 8 SWIFT: POFICHBEXXX Postfinance, 3030 Berne Your donation is tax deductible in Switzerland. Stay in touch With your donations, we help others For over 75 years , the Fondation suisse de la Chaîne du Bonheur « Solidarity » has embodied the solidarity of the people of Switzerland . In partnership with the Broadcasting Corporation SRG-SSR and private media entities , the foundation alerts the public and appeals for donations for victims of natural disasters and conflicts , child relief and vulnerable people in Switzerland . Abroad , Solidarity supports the humanitarian projects of its 26 partner NGOs . In Switzerland , Solidarity works with various local organisations when gaps in the social welfare system become evident . The foundation functions independently , responsibly and transparently , monitoring projects and seeing to the judicious use of donations. Since 1946, Solidarity has raised over two billion francs. © Solidarity General Conditions of Use Data privacy statement Legal Notice Website by Procab Fundraising campaigns INTERNATIONALLY IN SWITZERLAND ContactIf you have any questions or would like to know more about our Foundation, please contact us. We will be happy to answer you. Contact Form Where to find us Phone number Welcome to Solidarity. By selecting « accept all », you allow us to use cookies to improve your browsing experience. You can also customize your preferences by clicking on « cookie settings ». We wish you a pleasant visit! To find out more about our data privacy statement , please visit our dedicated page. Accept all Reject all Cookie settings Managing consent Close Privacy Overview This website uses cookies to enhance your experience when browsing the site. Of these, cookies that are categorized as necessary are stored on . Necessary Necessary Always Enabled Necessary cookies are absolutely essential for the website to function properly. These cookies ensure basic functionalities and security features of the website, anonymously. Cookie Duration Description _GRECAPTCHA 5 months 27 days Google Recaptcha service sets this cookie to identify bots to protect the website against malicious spam attacks. cookielawinfo-checkbox-advertisement 1 year Set by the GDPR Cookie Consent plugin, this cookie records the user consent for the cookies in the "Advertisement" category. cookielawinfo-checkbox-analytics 1 year Set by the GDPR Cookie Consent plugin, this cookie records the user consent for the cookies in the "Analytics" category. cookielawinfo-checkbox-functional 1 year The GDPR Cookie Consent plugin sets the cookie to record the user consent for the cookies in the category "Functional". cookielawinfo-checkbox-necessary 1 year Set by the GDPR Cookie Consent plugin, this cookie records the user consent for the cookies in the "Necessary" category. cookielawinfo-checkbox-others 1 year Set by the GDPR Cookie Consent plugin, this cookie stores user consent for cookies in the category "Others". cookielawinfo-checkbox-performance 1 year Set by the GDPR Cookie Consent plugin, this cookie stores the user consent for cookies in the category "Performance". CookieLawInfoConsent 1 year CookieYes sets this cookie to record the default button state of the corresponding category and the status of CCPA. It works only in coordination with the primary cookie. wp-wpml_current_language session WordPress multilingual plugin sets this cookie to store the current language/language settings. Analytics analytics Analytical cookies are used to understand how visitors interact with the website. These cookies help provide information on metrics the number of visitors, bounce rate, traffic source, etc. Cookie Duration Description _fbp 3 months Facebook sets this cookie to display advertisements when either on Facebook or on a digital platform powered by Facebook advertising after visiting the website. _ga 1 year 1 month 4 days Google Analytics sets this cookie to calculate visitor, session and campaign data and track site usage for the site’s analytics report. The cookie stores information anonymously and assigns a randomly generated number to recognise unique visitors. _ga_* 1 year 1 month 4 days Google Analytics sets this cookie to store and count page views. _gat_UA-* 1 minute Google Analytics sets this cookie for user behaviour tracking.n _gid 1 day Google Analytics sets this cookie to store information on how visitors use a website while also creating an analytics report of the website’s performance. Some of the collected data includes the number of visitors, their source, and the pages they visit anonymously. AnalyticsSyncHistory 1 month Linkedin set this cookie to store information about the time a sync took place with the lms_analytics cookie. CONSENT 2 years YouTube sets this cookie via embedded YouTube videos and registers anonymous statistical data. ln_or 1 day Linkedin sets this cookie to registers statistical data on users’ behaviour on the website for internal analytics. Functional functional Functional cookies help to perform certain functionalities like sharing the content of the website on social media platforms, collect feedbacks, and other...
Domain Name: swiss-solidarity.org Registry Domain ID: 1f6c9ca55606450b87cfb9d7e4ba51be-LROR Registrar WHOIS Server: http://whois.rrpproxy.net Registrar URL: http://www.key-systems.net Updated Date: 2023-03-27T10:18:43Z Creation Date: 2000-03-08T09:44:15Z Registry Expiry Date: 2029-03-08T09:44:15Z Registrar: Key-Systems GmbH Registrar IANA ID: 269 Registrar Abuse Contact Email: abuse@key-systems.net Registrar Abuse Contact Phone: +49.68949396850 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registrant State/Province: GE Registrant Country: CH Name Server: ns41.infomaniak.com Name Server: ns42.infomaniak.com DNSSEC: unsigned >>> Last update of WHOIS database: 2024-05-18T03:25:10Z <<<